Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0515800_circ_g.6 |
ID in PlantcircBase | osa_circ_039841 |
Alias | Os_ciR4158 |
Organism | Oryza sativa |
Position | chr9: 20088496-20089665 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os09g0515800 |
Parent gene annotation |
RabGAP/TBC domain containing protein. (Os09t0515800-01) |
Parent gene strand | - |
Alternative splicing | Os09g0515800_circ_g.1 Os09g0515800_circ_g.2 Os09g0515800_circ_g.3 Os09g0515800_circ_g.4 Os09g0515800_circ_g.5 Os09g0515800_circ_g.7 Os09g0515800_circ_g.8 Os09g0515800_circ_g.9 Os09g0515800_circ_g.10 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0515800-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008167* |
PMCS | 0.41800537 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20088500-20089596(-) 20088735-20089627(-) |
Potential amino acid sequence |
MNAQRAELSWEGLADPKIRTSFTS*(-) MIFLILNALMKRLICFDRLLLIAQELCQMLPFSSTLKFRNLWSAFCIHECSKGGAFLGRSC*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |