Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA006535_circ_g.23 |
ID in PlantcircBase | osi_circ_003899 |
Alias | 2:16008479|16010280 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 16008479-16010280 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA006535 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA006535_circ_g.1 BGIOSGA006535_circ_g.2 BGIOSGA006535_circ_g.3 BGIOSGA006535_circ_g.4 BGIOSGA006535_circ_g.5 BGIOSGA006535_circ_g.6 BGIOSGA006535_circ_g.7 BGIOSGA006535_circ_g.8 BGIOSGA006535_circ_g.9 BGIOSGA006535_circ_g.10 BGIOSGA006535_circ_g.11 BGIOSGA006535_circ_g.12 BGIOSGA006535_circ_g.13 BGIOSGA006535_circ_g.14 BGIOSGA006535_circ_g.15 BGIOSGA006535_circ_g.16 BGIOSGA006535_circ_g.17 BGIOSGA006535_circ_g.18 BGIOSGA006535_circ_g.19 BGIOSGA006535_circ_g.20 BGIOSGA006535_circ_g.21 BGIOSGA006535_circ_g.22 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA006535-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_014591* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16010275-16010262(-) 16010108-16008484(+) |
Potential amino acid sequence |
MFLNDMSGRNPLYKKAYVFFSSPIQKELVTQIKKDSSVLPRIGALSEMNLEYFAIDSQGFTTDH ERALEELFSENALDSHKYNACLNTMATRISTVFASMRHWDVPE*(-) MGELKNTYAFLYNGFLPDMSFRNIPMPH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |