Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0320100_circ_g.1 |
ID in PlantcircBase | osa_circ_019535 |
Alias | Os_ciR8462 |
Organism | Oryza sativa |
Position | chr3: 11550445-11550866 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0320100 |
Parent gene annotation |
Alpha-L-arabinofuranosidase, C-terminal domain containing protei n. (Os03t0320100-01) |
Parent gene strand | - |
Alternative splicing | Os03g0320100_circ_g.2 Os03g0320100_circ_g.3 Os03g0320100_circ_igg.1 Os03g0320100_circ_igg.2 Os03g0320100_circ_g.3 Os03g0320100_circ_g.4 Os03g0320100_circ_igg.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0320100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004774* |
PMCS | 0.233980529 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11550850-11550534(+) 11550807-11550863(-) 11550475-11550863(-) |
Potential amino acid sequence |
MASGLNLVRLLERVLIPQPTRCKHRLYGPEFLNAIL*(+) MLHFFKDSSGATLHPLTIQVSNYDQLAASALTWQNSNDGNTYLKIKVVNFGNKAVNLNIAVAGL ENGIQEFGSIKTVLTSGWLRDENSFQQPDKV*(-) MRTLSNSLTRFSPDAIVFNSWQHYGCPNYWMLHFFKDSSGATLHPLTIQVSNYDQLAASALTWQ NSNDGNTYLKIKVVNFGNKAVNLNIAVAGLENGIQEFGSIKTVLTSGWLRDENSFQQPDKV*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |