Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0320100_circ_g.1 |
| ID in PlantcircBase | osa_circ_019535 |
| Alias | Os_ciR8462 |
| Organism | Oryza sativa |
| Position | chr3: 11550445-11550866 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0320100 |
| Parent gene annotation |
Alpha-L-arabinofuranosidase, C-terminal domain containing protei n. (Os03t0320100-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0320100_circ_g.2 Os03g0320100_circ_g.3 Os03g0320100_circ_igg.1 Os03g0320100_circ_igg.2 Os03g0320100_circ_g.3 Os03g0320100_circ_g.4 Os03g0320100_circ_igg.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0320100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004774* |
| PMCS | 0.233980529 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11550850-11550534(+) 11550807-11550863(-) 11550475-11550863(-) |
| Potential amino acid sequence |
MASGLNLVRLLERVLIPQPTRCKHRLYGPEFLNAIL*(+) MLHFFKDSSGATLHPLTIQVSNYDQLAASALTWQNSNDGNTYLKIKVVNFGNKAVNLNIAVAGL ENGIQEFGSIKTVLTSGWLRDENSFQQPDKV*(-) MRTLSNSLTRFSPDAIVFNSWQHYGCPNYWMLHFFKDSSGATLHPLTIQVSNYDQLAASALTWQ NSNDGNTYLKIKVVNFGNKAVNLNIAVAGLENGIQEFGSIKTVLTSGWLRDENSFQQPDKV*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |