Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0320100_circ_g.4 |
| ID in PlantcircBase | osa_circ_019541 |
| Alias | Os_ciR8464 |
| Organism | Oryza sativa |
| Position | chr3: 11551421-11551524 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0320100 |
| Parent gene annotation |
Alpha-L-arabinofuranosidase, C-terminal domain containing protei n. (Os03t0320100-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0320100_circ_g.1 Os03g0320100_circ_g.2 Os03g0320100_circ_g.3 Os03g0320100_circ_igg.1 Os03g0320100_circ_igg.2 Os03g0320100_circ_g.3 Os03g0320100_circ_igg.5 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0320100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.597190385 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11551440-11551439(+) |
| Potential amino acid sequence |
MRNAASARAATNVPRPASFPVTAYSLTNACFFLIQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |