Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0484300_circ_g.4 |
ID in PlantcircBase | osa_circ_033826 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 17748328-17753489 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0484300 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os07 t0484300-01);Similar to protein binding protein. (Os07t0484300-0 2) |
Parent gene strand | - |
Alternative splicing | Os07g0484300_circ_g.1 Os07g0484300_circ_g.2 Os07g0484300_circ_g.3 Os07g0484300_circ_g.5 Os07g0484300_circ_g.6 Os07g0484300_circ_g.7 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0484300-01:9 Os07t0484300-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007184* |
PMCS | 0.251940407 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17752405-17753470(-) 17748375-17753460(-) |
Potential amino acid sequence |
MFQSLARERLEQLNASPSATPSKYFRVYSALLLVLSADVLWIKLCVGFCKSCNSQLFWLMFFEP LSIGFETLQSIMVHGFQLFDIWQRHQMDSGVDYLDFQKTYKQAAGSFSEWRGRLVRNFGFVIDL ISLLMSLGHYSMIFWLRGMAFHLVDAVLLLNLRALIASFWKRIKTYAKLRKALSSLDGALPDAT YDEICAYDDECAICRGPMARAKKLSCNHLFHLACLRSWLDQGLMDGYSCPTCRRPLFLSSQGHT RSTAEVGNVQLIAEQLNAGLNQQRVPGHEHPIEHQNPADAVWRHYFLFN*(-) MNILLNIRILQMLFGDTIFCSINLF*(-) |
Sponge-miRNAs | osa-miR1861a |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |