Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G23900_circ_g.10 |
| ID in PlantcircBase | ath_circ_004102 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 8444211-8444562 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G23900 |
| Parent gene annotation |
AP-1 complex subunit gamma-1 |
| Parent gene strand | + |
| Alternative splicing | AT1G23900_circ_g.1 1_circ_ag.2 1_circ_ag.3 AT1G23900_circ_g.4 1_circ_ag.5 1_circ_ag.6 AT1G23900_circ_g.7 AT1G23900_circ_g.8 AT1G23900_circ_g.9 AT1G23900_circ_g.11 AT1G23900_circ_g.12 AT1G23900_circ_g.13 1_circ_ag.14 1_circ_ag.15 AT1G23935_circ_g.1 AT1G23935_circ_g.2 |
| Support reads | 4 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G23900.1:2 AT1G23900.3:2 AT1G23900.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297849581 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8444542-8444559(+) |
| Potential amino acid sequence |
MLKVLCEDPDASIRKRALELVTLLVNENNVTQLTKELIDYLEISDEDFKEDLSAKICFIVEKFS PEKLWYIDQMLKVLCEDPDASIRKRALELVTLLVNENNVTQLTKELIDYLEISDEDFKEDLSAK ICFIVEKFSPEKLWYIDQMLKVLCEDPDASIRKRALELVTLLVNENNVTQLTKELIDYLEISDE DFKEDLSAKICFIVEKFSPEKLWYIDQMLKVLCE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |