Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0181100_circ_g.2 |
| ID in PlantcircBase | osa_circ_008700 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 4079211-4081009 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0181100 |
| Parent gene annotation |
Similar to Transmembrane protein TM9SF3 (Fragment). (Os11t018110 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0181100_circ_g.1 Os11g0181100_circ_g.3 Os11g0181100_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0181100-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003044* |
| PMCS | 0.167071248 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4080090-4079241(+) |
| Potential amino acid sequence |
MTYSVKWVQTNVAFARRFEVYLDYPFFEHQIHWFSIFNSFMMVIFLTGLVSMILMRTLRNDYAK YAREDDDLESLERDVSEESGWKLVHGDVFRPPRSLVFLSAFVGIGTQLAALILLVIVLAIVGML YVGTKLKKRLNSG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |