Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0181100_circ_g.2 |
ID in PlantcircBase | osa_circ_008700 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 4079211-4081009 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0181100 |
Parent gene annotation |
Similar to Transmembrane protein TM9SF3 (Fragment). (Os11t018110 0-01) |
Parent gene strand | + |
Alternative splicing | Os11g0181100_circ_g.1 Os11g0181100_circ_g.3 Os11g0181100_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0181100-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003044* |
PMCS | 0.167071248 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4080090-4079241(+) |
Potential amino acid sequence |
MTYSVKWVQTNVAFARRFEVYLDYPFFEHQIHWFSIFNSFMMVIFLTGLVSMILMRTLRNDYAK YAREDDDLESLERDVSEESGWKLVHGDVFRPPRSLVFLSAFVGIGTQLAALILLVIVLAIVGML YVGTKLKKRLNSG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |