Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA032684_circ_g.3 |
ID in PlantcircBase | osi_circ_002773 |
Alias | 10:7063612|7065966 |
Organism | Oryza sativa ssp. indica |
Position | chr10: 7063612-7065966 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA032684 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA032684_circ_g.1 BGIOSGA032684_circ_g.2 BGIOSGA032684_circ_g.3 BGIOSGA032684_circ_igg.1 BGIOSGA032684_circ_g.2 BGIOSGA032684_circ_g.4 BGIOSGA032684_circ_igg.5 BGIOSGA032684_circ_g.6 BGIOSGA032684_circ_g.7 BGIOSGA032684_circ_g.8 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA032684-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7063834-7065946(-) 7065900-7063651(+) 7063889-7063638(+) |
Potential amino acid sequence |
MTYLLSFSGPEVNLWSALLTLTDVELIPPQRPLSEVMATITFFLTSTHKKTGTR*(-) MKLKEVKLNQKFFRILPSSSFLVCRCQEECYCSHYL*(+) MTVSELQKNPINYTQIAVLADDILKNVEYDALRVVFNKFHSVISFKPTMTTILSPEVMEKESES GKVGDLDSYEIEGGETKSEILQNLTEFQFSCVSMSRRMLL*(+) |
Sponge-miRNAs | osa-miR529a |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |