Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA001977_circ_g.7 |
ID in PlantcircBase | osi_circ_001947 |
Alias | 1:9261070|9261310 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 9261070-9261310 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA001977 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA001977_circ_g.4 BGIOSGA001977_circ_g.5 BGIOSGA001977_circ_g.6 BGIOSGA001977_circ_g.8 BGIOSGA001977_circ_g.9 BGIOSGA001977_circ_g.10 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA001977-TA:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_001142* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9261259-9261289(-) 9261274-9261136(+) |
Potential amino acid sequence |
MKVKDLSRGHILGFVKSQLVLVWCSLTQLRITFWLLVKIIRLSSGMLIIQPCLALLKLTEAYRL FSCGTSKDGDSYLVEWNESEGSIKRTYSGFRKKSAGVGVVQFDTAQNHILAAGEDNQIKFWDVD NTTMLSSTEADGGLPVVLMWNK*(-) MNLHLYLFHMRTTGKPPSASVELSMVVLSTSQNLI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |