Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA001977_circ_g.7 |
| ID in PlantcircBase | osi_circ_001947 |
| Alias | 1:9261070|9261310 |
| Organism | Oryza sativa ssp. indica |
| Position | chr1: 9261070-9261310 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA001977 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA001977_circ_g.4 BGIOSGA001977_circ_g.5 BGIOSGA001977_circ_g.6 BGIOSGA001977_circ_g.8 BGIOSGA001977_circ_g.9 BGIOSGA001977_circ_g.10 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA001977-TA:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_001142* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9261259-9261289(-) 9261274-9261136(+) |
| Potential amino acid sequence |
MKVKDLSRGHILGFVKSQLVLVWCSLTQLRITFWLLVKIIRLSSGMLIIQPCLALLKLTEAYRL FSCGTSKDGDSYLVEWNESEGSIKRTYSGFRKKSAGVGVVQFDTAQNHILAAGEDNQIKFWDVD NTTMLSSTEADGGLPVVLMWNK*(-) MNLHLYLFHMRTTGKPPSASVELSMVVLSTSQNLI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |