Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0254100_circ_g.9 |
| ID in PlantcircBase | osa_circ_001142 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 8424402-8424642 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0254100 |
| Parent gene annotation |
Similar to CTV.2. (Os01t0254100-01);Similar to Lissencephaly typ e-1-like homology motif; CTLH, C-terminal to LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; Quinonprotein alcohol d ehydrogenase-like. (Os01t0254100-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0254100_circ_g.6 Os01g0254100_circ_g.7 Os01g0254100_circ_g.8 Os01g0254100_circ_g.10 Os01g0254100_circ_g.11 Os01g0254100_circ_g.12 Os01g0254100_circ_g.13 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0254100-02:1 Os01t0254100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_001947* |
| PMCS | 0.744589419 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8424606-8424468(+) 8424591-8424621(-) |
| Potential amino acid sequence |
MNLHLYLFHMRTTGKPPSASVELSMVVLSTSQNLI*(+) MKVKDLSRGHILGFVKSQLVLVWCSLTQLRITFWLLVKIIRLSSGMLIIQPCLALLKLTEAYRL FSCGTSKDGDSYLVEWNESEGSIKRTYSGFRKKSAGVGVVQFDTAQNHILAAGEDNQIKFWDVD NTTMLSSTEADGGLPVVLMWNK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |