Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0254100_circ_g.9 |
ID in PlantcircBase | osa_circ_001142 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 8424402-8424642 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0254100 |
Parent gene annotation |
Similar to CTV.2. (Os01t0254100-01);Similar to Lissencephaly typ e-1-like homology motif; CTLH, C-terminal to LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; Quinonprotein alcohol d ehydrogenase-like. (Os01t0254100-02) |
Parent gene strand | - |
Alternative splicing | Os01g0254100_circ_g.6 Os01g0254100_circ_g.7 Os01g0254100_circ_g.8 Os01g0254100_circ_g.10 Os01g0254100_circ_g.11 Os01g0254100_circ_g.12 Os01g0254100_circ_g.13 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0254100-02:1 Os01t0254100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_001947* |
PMCS | 0.744589419 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8424606-8424468(+) 8424591-8424621(-) |
Potential amino acid sequence |
MNLHLYLFHMRTTGKPPSASVELSMVVLSTSQNLI*(+) MKVKDLSRGHILGFVKSQLVLVWCSLTQLRITFWLLVKIIRLSSGMLIIQPCLALLKLTEAYRL FSCGTSKDGDSYLVEWNESEGSIKRTYSGFRKKSAGVGVVQFDTAQNHILAAGEDNQIKFWDVD NTTMLSSTEADGGLPVVLMWNK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |