Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0376500_circ_g.4 |
ID in PlantcircBase | osa_circ_023549 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 18402332-18403387 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0376500 |
Parent gene annotation |
Similar to Eukaryotic translation initiation factor 3 subunit 3 (eIF-3 gamma) (eIF3 p38 subunit) (eIF3h). (Os04t0376500-01);Simi lar to eukaryotic translation initiation factor 3 subunit 3. (Os 04t0376500-02) |
Parent gene strand | - |
Alternative splicing | Os04g0376500_circ_g.3 Os04g0376500_circ_g.5 Os04g0376500_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0376500-02:5 Os04t0376500-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.194930919 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18403334-18403342(-) 18402359-18403342(-) |
Potential amino acid sequence |
MNYQENIRRCVCIVYDPSRSNQGVLALKALKLTDSFMDLYRNNGLTGEKLREKKLSWVDIFEEI PIKVSNSALVSAFMTELEPESPVSQCDFDRLKLSTAPFMERNLEFLIGCMDDLSSEQNKVSILL AWIFSDCGTD*(-) MIFHQSRTRYQSCLLGSFQTVELIETFMNYQENIRRCVCIVYDPSRSNQGVLALKALKLTDSFM DLYRNNGLTGEKLREKKLSWVDIFEEIPIKVSNSALVSAFMTELEPESPVSQCDFDRLKLSTAP FMERNLEFLIGCMDDLSSEQNKVSILLAWIFSDCGTD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |