Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0376500_circ_g.4 |
| ID in PlantcircBase | osa_circ_023549 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 18402332-18403387 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0376500 |
| Parent gene annotation |
Similar to Eukaryotic translation initiation factor 3 subunit 3 (eIF-3 gamma) (eIF3 p38 subunit) (eIF3h). (Os04t0376500-01);Simi lar to eukaryotic translation initiation factor 3 subunit 3. (Os 04t0376500-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0376500_circ_g.3 Os04g0376500_circ_g.5 Os04g0376500_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0376500-02:5 Os04t0376500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.194930919 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18403334-18403342(-) 18402359-18403342(-) |
| Potential amino acid sequence |
MNYQENIRRCVCIVYDPSRSNQGVLALKALKLTDSFMDLYRNNGLTGEKLREKKLSWVDIFEEI PIKVSNSALVSAFMTELEPESPVSQCDFDRLKLSTAPFMERNLEFLIGCMDDLSSEQNKVSILL AWIFSDCGTD*(-) MIFHQSRTRYQSCLLGSFQTVELIETFMNYQENIRRCVCIVYDPSRSNQGVLALKALKLTDSFM DLYRNNGLTGEKLREKKLSWVDIFEEIPIKVSNSALVSAFMTELEPESPVSQCDFDRLKLSTAP FMERNLEFLIGCMDDLSSEQNKVSILLAWIFSDCGTD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |