Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0231800_circ_g.1 |
| ID in PlantcircBase | osa_circ_018730 |
| Alias | Os_ciR3885 |
| Organism | Oryza sativa |
| Position | chr3: 6958237-6959434 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0231850 |
| Parent gene annotation |
Hypothetical protein. (Os03t0231850-00) |
| Parent gene strand | + |
| Alternative splicing | Os03g0231700_circ_g.3 Os03g0231750_circ_ag.1 Os03g0231750_circ_ag.2 Os03g0231750_circ_ag.3 Os03g0231700_circ_g.4 Os03g0231800_circ_g.2 Os03g0231800_circ_g.3 Os03g0231800_circ_g.4 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0231800-02:4 Os03t0231800-03:4 Os03t0231800-02:4 Os03t0231850-00:4 Os03t0231800-03:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.596894157 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6959005-6959398(-) |
| Potential amino acid sequence |
MAKYLKTVVAPQIPPEIYDSFIAAIDKGSIRTMPNRSMPAAPHPTPGALLMGDAFNMRHPLTGG GMTVALSDIVVLRNLLKPLRNLHDASALCKYLESFYTLRKPVASTINTLAGALYKVFSASPDQA RNEMRQACFDYLSLGGVFSNGPIALLSGLNPRPLSLVAHFFAVAIYGVGRLMLPLPSPKRMWIG VRLISCSIGARNCYIIG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |