Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0231800_circ_g.1 |
ID in PlantcircBase | osa_circ_018730 |
Alias | Os_ciR3885 |
Organism | Oryza sativa |
Position | chr3: 6958237-6959434 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0231850 |
Parent gene annotation |
Hypothetical protein. (Os03t0231850-00) |
Parent gene strand | + |
Alternative splicing | Os03g0231700_circ_g.3 Os03g0231750_circ_ag.1 Os03g0231750_circ_ag.2 Os03g0231750_circ_ag.3 Os03g0231700_circ_g.4 Os03g0231800_circ_g.2 Os03g0231800_circ_g.3 Os03g0231800_circ_g.4 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0231800-02:4 Os03t0231800-03:4 Os03t0231800-02:4 Os03t0231850-00:4 Os03t0231800-03:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.596894157 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6959005-6959398(-) |
Potential amino acid sequence |
MAKYLKTVVAPQIPPEIYDSFIAAIDKGSIRTMPNRSMPAAPHPTPGALLMGDAFNMRHPLTGG GMTVALSDIVVLRNLLKPLRNLHDASALCKYLESFYTLRKPVASTINTLAGALYKVFSASPDQA RNEMRQACFDYLSLGGVFSNGPIALLSGLNPRPLSLVAHFFAVAIYGVGRLMLPLPSPKRMWIG VRLISCSIGARNCYIIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |