Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0514500_circ_g.7 |
ID in PlantcircBase | osa_circ_011594 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 19926727-19927095 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0514500 |
Parent gene annotation |
Similar to Heat-shock protein precursor. (Os12t0514500-01);Simil ar to ATP binding. (Os12t0514500-02);Similar to ATP binding. (Os 12t0514500-03) |
Parent gene strand | - |
Alternative splicing | Os12g0514500_circ_g.4 Os12g0514500_circ_g.5 Os12g0514500_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0514500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.306623397 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19926908-19926771(+) 19926790-19927094(-) |
Potential amino acid sequence |
MLLHRWRIRRINCCSTRFISPANKGTLPQLEGGSIVGPGKLGRSKHREQPLLKLRDTRLPINHL TSSRRNTSLLLYKL*(+) MDLIVHSLYSNKEVFLRELVR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |