Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0514500_circ_g.6 |
| ID in PlantcircBase | osa_circ_011593 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 19925833-19926384 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0514500 |
| Parent gene annotation |
Similar to Heat-shock protein precursor. (Os12t0514500-01);Simil ar to ATP binding. (Os12t0514500-02);Similar to ATP binding. (Os 12t0514500-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0514500_circ_g.4 Os12g0514500_circ_g.5 Os12g0514500_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0514500-01:3 Os12t0514500-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003454* osi_circ_009753 |
| PMCS | 0.225465791 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19925938-19926384(-) |
| Potential amino acid sequence |
MFGKARQNLVLTPLERRQTQRSSFLGELALLCTLSDTGIGMTRQELVDSLGTIASSGTAKFLKA LKESQEAGVDSNLIGQFGVGFYSAFLVSDKVAVSTKSPKSDKQYVWEGEAESSSYTIREETDPE KLLPRGTRLTLYLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |