Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0367100_circ_g.3 |
ID in PlantcircBase | osa_circ_030803 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 15342141-15342783 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0367100 |
Parent gene annotation |
Glycoside hydrolase, subgroup, catalytic core domain containing protein. (Os06t0367100-01);Similar to starch branching enzyme II I. (Os06t0367100-02) |
Parent gene strand | + |
Alternative splicing | Os06g0367100_circ_g.1 Os06g0367100_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0367100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008295 osi_circ_019043 |
PMCS | 0.136210951 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15342716-15342163(+) |
Potential amino acid sequence |
MHQQMNWLAYPSLMVLMIVTSTAVTNYFSVSSRFGSPDDFKKLVDEAHGLGLVVLLDIVHSYAS ADELVGLSLFDGSNDCYFHSGHQLFFSQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |