Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G07050_circ_g.5 |
ID in PlantcircBase | ath_circ_012998 |
Alias | At_ciR312, AT2G07050_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 2925886-2926336 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
Parent gene | AT2G07050 |
Parent gene annotation |
Cycloartenol synthase |
Parent gene strand | + |
Alternative splicing | AT2G07050_circ_g.1 AT2G07050_circ_g.2 AT2G07050_circ_g.3 AT2G07050_circ_g.4 AT2G07050_circ_g.6 AT2G07050_circ_g.7 AT2G07050_circ_g.8 AT2G07050_circ_g.9 AT2G07050_circ_g.10 AT2G07050_circ_g.11 AT2G07050_circ_g.12 AT2G07050_circ_g.13 AT2G07050_circ_g.14 AT2G07050_circ_g.15 AT2G07050_circ_g.16 AT2G07050_circ_g.17 |
Support reads | 29/5 |
Tissues | leaf/root, leaf, aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G07050.1:2 AT2G07050.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.62898616 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2925949-2926333(+) |
Potential amino acid sequence |
MRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGPNDGDGDMEKGRDWILNHGGATN ITSWGKMWLSIITLSITGALNTVLSEQHKQEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYV TLRLLGEGPNDGDGDMEKGRDWILNHGGATNITSWGKMWLSIITLSITGALNTVLSEQHKQEMR RYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTLRLLGEGPNDGDGDMEKGRDWILNHGGATNIT SWGKMWLSIITLSITGALNTVLSEQHKQEMRRYLYNHQNEDGGWGLHIEGPSTMFGSVLNYVTL RLLGEGPNDGDGDMEKGRDWILNHGGATNITSWGKMWLS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |