Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0106100_circ_g.4 |
| ID in PlantcircBase | osa_circ_029327 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 414733-414820 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0106100 |
| Parent gene annotation |
Cwf15/Cwc15 cell cycle control protein family protein. (Os06t010 6100-01);Similar to pre-mRNA-splicing factor cwc15. (Os06t010610 0-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0106100_circ_g.1 Os06g0106100_circ_g.2 Os06g0106100_circ_g.3 Os06g0106100_circ_g.5 Os06g0106100_circ_g.6 Os06g0106100_circ_g.7 |
| Support reads | 8 |
| Tissues | anther, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0106100-01:1 Os06t0106100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.242536364 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
414777-414804(-) |
| Potential amino acid sequence |
MQMILMWNPEVMMKGSRREAEDKIVPREIDADDSDVEPRSDDERFKERG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |