Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0106100_circ_g.5 |
ID in PlantcircBase | osa_circ_029328 |
Alias | Os_ciR10704 |
Organism | Oryza sativa |
Position | chr6: 414733-415223 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0106100 |
Parent gene annotation |
Cwf15/Cwc15 cell cycle control protein family protein. (Os06t010 6100-01);Similar to pre-mRNA-splicing factor cwc15. (Os06t010610 0-02) |
Parent gene strand | - |
Alternative splicing | Os06g0106100_circ_g.1 Os06g0106100_circ_g.2 Os06g0106100_circ_g.3 Os06g0106100_circ_g.4 Os06g0106100_circ_g.6 Os06g0106100_circ_g.7 |
Support reads | 2/2 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0106100-02:3 Os06t0106100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.263549728 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
415209-414815(+) 414777-414907(-) |
Potential amino acid sequence |
MLSFFPFIITSGFHIRIICIDFSRNYLILSLSP*(+) MQMILMWNPEVMMKGKKDNIPKKSYRRGISGTNLRSVRGSTTRQRTSPMLRREIGGKAQAYS*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |