Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0106100_circ_g.5 |
| ID in PlantcircBase | osa_circ_029328 |
| Alias | Os_ciR10704 |
| Organism | Oryza sativa |
| Position | chr6: 414733-415223 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0106100 |
| Parent gene annotation |
Cwf15/Cwc15 cell cycle control protein family protein. (Os06t010 6100-01);Similar to pre-mRNA-splicing factor cwc15. (Os06t010610 0-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0106100_circ_g.1 Os06g0106100_circ_g.2 Os06g0106100_circ_g.3 Os06g0106100_circ_g.4 Os06g0106100_circ_g.6 Os06g0106100_circ_g.7 |
| Support reads | 2/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0106100-02:3 Os06t0106100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.263549728 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
415209-414815(+) 414777-414907(-) |
| Potential amino acid sequence |
MLSFFPFIITSGFHIRIICIDFSRNYLILSLSP*(+) MQMILMWNPEVMMKGKKDNIPKKSYRRGISGTNLRSVRGSTTRQRTSPMLRREIGGKAQAYS*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |