Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0421900_circ_g.5 |
ID in PlantcircBase | osa_circ_023820 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 20869426-20870483 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0421900 |
Parent gene annotation |
Similar to H0525E10.11 protein. (Os04t0421900-01) |
Parent gene strand | + |
Alternative splicing | Os04g0421900_circ_g.2 Os04g0421900_circ_g.3 Os04g0421900_circ_g.4 Os04g0421900_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0421900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.214543919 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20869452-20869428(+) 20869454-20869477(-) 20869513-20870458(-) |
Potential amino acid sequence |
MRDLMTSFSALEEKVLEQYTFAKSNLIRNAARNYLLDYGIHWGAAPAVKG*(+) MSALRSSLSLYCWCCSPVNPIIQQIVSCSISDQVRLCKCILFQDFLLKC*(-) MYTVPGLSPQVLRKKSSDLACQHYAHHYPFTAGAAPQ*(-) |
Sponge-miRNAs | osa-miR2922 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |