Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0357800_circ_g.2 |
ID in PlantcircBase | osa_circ_027559 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 16978848-16979967 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0357800 |
Parent gene annotation |
Phospholipid/glycerol acyltransferase domain containing protein. (Os05t0357800-01) |
Parent gene strand | - |
Alternative splicing | Os05g0357800_circ_g.1 Os05g0357800_circ_g.3 Os05g0357800_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0357800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.114411131 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16979951-16978895(+) 16978868-16979414(-) 16979372-16979931(-) |
Potential amino acid sequence |
MHPRHLPRHRIPCWTKSLVRIS*(+) MGFDVWANVLDAFLFSGNLKPQISKAFQVL*(-) MMLLFPEGTTTNGDYLLPFKTGAFLAKAPVKPVILRYPYKRFSPAWDSMSGQMSWMHFCSAGI* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |