Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0357800_circ_g.1 |
| ID in PlantcircBase | osa_circ_027558 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 16978848-16979420 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0357800 |
| Parent gene annotation |
Phospholipid/glycerol acyltransferase domain containing protein. (Os05t0357800-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0357800_circ_g.2 Os05g0357800_circ_g.3 Os05g0357800_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0357800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.144078767 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16979390-16978884(+) 16978868-16979414(-) 16979372-16979414(-) |
| Potential amino acid sequence |
MSPLDSLSHSTPDIESHAGLNLL*(+) MGFDVWGAVTERIQRAHQQKNSPMMLLFPEGTTTNGDYLLPFKTGAFLAKAPVKPVILRYPYKR FSPAWDSMSGVL*(-) MMLLFPEGTTTNGDYLLPFKTGAFLAKAPVKPVILRYPYKRFSPAWDSMSGVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |