Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0270200_circ_g.6 |
ID in PlantcircBase | osa_circ_019088 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 9031604-9031717 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0270200 |
Parent gene annotation |
Hypothetical conserved gene. (Os03t0270200-01);Splicing factor P WI domain containing protein. (Os03t0270200-02);Conserved hypoth etical protein. (Os03t0270200-03) |
Parent gene strand | - |
Alternative splicing | Os03g0270200_circ_g.4 Os03g0270200_circ_g.5 Os03g0270200_circ_g.7 Os03g0270200_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0270200-01:1 Os03t0270200-03:1 Os03t0270200-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.097953216 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9031638-9031606(+) 9031685-9031714(+) 9031618-9031670(-) |
Potential amino acid sequence |
MPFVPFSMSLLKLLREWIGLLSCGLVLL*(+) MDWAPIVWTGTPLKHIYIVTGGNAVCSFFNVSTQAPARMDWAPIVWTGTPLKHIYIVTGGNAVC SFFNVSTQAPARMDWAPIVWTGTPLKHIYIVTGGNAVCSFFNVSTQAPARMDWAPIVWTGT(+) MCFKGVPVHTIGAQSILAGA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |