Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0270200_circ_g.4 |
| ID in PlantcircBase | osa_circ_019086 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 9030998-9031717 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0270200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os03t0270200-01);Splicing factor P WI domain containing protein. (Os03t0270200-02);Conserved hypoth etical protein. (Os03t0270200-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0270200_circ_g.5 Os03g0270200_circ_g.6 Os03g0270200_circ_g.7 Os03g0270200_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0270200-01:4 Os03t0270200-03:4 Os03t0270200-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111805093 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9031638-9031250(+) 9031465-9031076(+) |
| Potential amino acid sequence |
MPFVPFSMSLLKLLREWIGLLSCGLVLLCCDGDFSPGLKSSCAFFSSRSAEKSLIFLRDEFAFR AFSLARLPSSSPLLSVLT*(+) MKDGHSLLYHSYCHRVIFLCSFEAHLHRYWRECRLFLFQCLYSSSCENGLGSYRVDWYSYVVME IFLQGSNHHVLSLVPDLLRNP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |