Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0270200_circ_g.4 |
ID in PlantcircBase | osa_circ_019086 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 9030998-9031717 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0270200 |
Parent gene annotation |
Hypothetical conserved gene. (Os03t0270200-01);Splicing factor P WI domain containing protein. (Os03t0270200-02);Conserved hypoth etical protein. (Os03t0270200-03) |
Parent gene strand | - |
Alternative splicing | Os03g0270200_circ_g.5 Os03g0270200_circ_g.6 Os03g0270200_circ_g.7 Os03g0270200_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0270200-01:4 Os03t0270200-03:4 Os03t0270200-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.111805093 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9031638-9031250(+) 9031465-9031076(+) |
Potential amino acid sequence |
MPFVPFSMSLLKLLREWIGLLSCGLVLLCCDGDFSPGLKSSCAFFSSRSAEKSLIFLRDEFAFR AFSLARLPSSSPLLSVLT*(+) MKDGHSLLYHSYCHRVIFLCSFEAHLHRYWRECRLFLFQCLYSSSCENGLGSYRVDWYSYVVME IFLQGSNHHVLSLVPDLLRNP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |