Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0492100_circ_g.4 |
ID in PlantcircBase | osa_circ_024353 |
Alias | Os_ciR3392 |
Organism | Oryza sativa |
Position | chr4: 24586753-24587438 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0492100 |
Parent gene annotation |
Similar to H0425E08.1 protein. (Os04t0492100-01) |
Parent gene strand | + |
Alternative splicing | Os04g0492100_circ_igg.1 EPlOSAG00000040437_circ_ig.1 Os04g0492100_circ_g.1 Os04g0492100_circ_g.2 Os04g0492100_circ_g.3 Os04g0492100_circ_g.5 Os04g0492100_circ_g.6 |
Support reads | 3/2 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0492100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014488 |
PMCS | 0.293784888 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24586961-24586809(+) 24587167-24587018(-) |
Potential amino acid sequence |
MAKNSLERYTHYYERWAANQSSRQKALGDLLSLQNDKLEKLSDIQSQPESQLKFIIEAWLQAVS WSMVGAWRTDWWILCL*(+) MPFASTTDWLPTVHNSVYISQASSLPFLFSFQIHHTLLPALLPHNGYRHKIHQSVLHAPTMDQD TACNQASMMNLSCDSGWLCISLNFSSLSFCKLSRSPNAFCLDD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |