Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0615500_circ_g.7 |
| ID in PlantcircBase | osa_circ_012314 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 26110864-26113914 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os12g0615500 |
| Parent gene annotation |
Similar to Hydrolase-like protein. (Os12t0615500-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0615500_circ_g.1 Os12g0615500_circ_g.2 Os12g0615500_circ_g.3 Os12g0615500_circ_g.4 Os12g0615500_circ_g.5 Os12g0615500_circ_g.6 Os12g0615500_circ_g.8 Os12g0615500_circ_g.9 Os12g0615500_circ_g.10 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0615500-01:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.421559539 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26113836-26111195(+) |
| Potential amino acid sequence |
MSSQHQLEYICVHFHLGNSQSEEKYCTFVKFTDQCRHAIHHGLTAHLSPPFWTTLPTFHCPCDG PFHQSSQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |