Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0615500_circ_g.1 |
ID in PlantcircBase | osa_circ_012308 |
Alias | Os_ciR946 |
Organism | Oryza sativa |
Position | chr12: 26104960-26110932 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRI, find_circ |
Parent gene | Os12g0615500 |
Parent gene annotation |
Similar to Hydrolase-like protein. (Os12t0615500-01) |
Parent gene strand | - |
Alternative splicing | Os12g0615500_circ_g.2 Os12g0615500_circ_g.3 Os12g0615500_circ_g.4 Os12g0615500_circ_g.5 Os12g0615500_circ_g.6 Os12g0615500_circ_g.7 Os12g0615500_circ_g.8 Os12g0615500_circ_g.9 Os12g0615500_circ_g.10 |
Support reads | 129/3 |
Tissues | root/seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0615500-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009971 |
PMCS | 0.496536761 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26106941-26110877(-) 26105013-26110924(-) |
Potential amino acid sequence |
MNSIAQKFPYLVRKKLKEGEEVRRVAQLDWRVIESDLQKPFVTSGLEFVPLPVIHGEDYVCLGF LFGRKSKVAYISDVSRFPPSTEHAISKSGEGQLDLLILDCLYRTGSHNVHLCWDQTLDAVKRIC PKRALLIGMTHEMDHHKDNETLEEWSRREGIDVQLARDGSRVYIDL*(-) MRWTITRTMKRWKSGPEGRG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |