Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0615500_circ_g.1 |
| ID in PlantcircBase | osa_circ_012308 |
| Alias | Os_ciR946 |
| Organism | Oryza sativa |
| Position | chr12: 26104960-26110932 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRI, find_circ |
| Parent gene | Os12g0615500 |
| Parent gene annotation |
Similar to Hydrolase-like protein. (Os12t0615500-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0615500_circ_g.2 Os12g0615500_circ_g.3 Os12g0615500_circ_g.4 Os12g0615500_circ_g.5 Os12g0615500_circ_g.6 Os12g0615500_circ_g.7 Os12g0615500_circ_g.8 Os12g0615500_circ_g.9 Os12g0615500_circ_g.10 |
| Support reads | 129/3 |
| Tissues | root/seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0615500-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009971 |
| PMCS | 0.496536761 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26106941-26110877(-) 26105013-26110924(-) |
| Potential amino acid sequence |
MNSIAQKFPYLVRKKLKEGEEVRRVAQLDWRVIESDLQKPFVTSGLEFVPLPVIHGEDYVCLGF LFGRKSKVAYISDVSRFPPSTEHAISKSGEGQLDLLILDCLYRTGSHNVHLCWDQTLDAVKRIC PKRALLIGMTHEMDHHKDNETLEEWSRREGIDVQLARDGSRVYIDL*(-) MRWTITRTMKRWKSGPEGRG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |