Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0149450_circ_g.1 |
ID in PlantcircBase | osa_circ_029682 |
Alias | Os_ciR4911 |
Organism | Oryza sativa |
Position | chr6: 2560267-2560548 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os06g0149400 |
Parent gene annotation |
Similar to Chitinase A. (Os06t0149400-01) |
Parent gene strand | + |
Alternative splicing | Os06g0149450_circ_g.2 Os06g0149450_circ_g.3 Os06g0149450_circ_g.4 Os06g0149450_circ_g.5 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0149450-00:2 Os06t0149400-01:2 Os06t0149450-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.302561939 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2560475-2560274(+) 2560277-2560340(-) |
Potential amino acid sequence |
MELLRLMVEMTNQPVKMLLRVKMQMGQHDEIELKFFEERAALEAKYQKLYEPLYTKRYNIVNGV VEVDGGNDEPASENAAEGKDADGPA*(+) MLAHLHLYPQQHFHWLVRHFHHQPQQLHLLCYTSLCTRVHKASGTSLQAQLSLQRILTRFHHAG PSASLPSAAFSLAGSSFPPSTSTTPFTMLYLFVYKGS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |