Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0149450_circ_g.2 |
ID in PlantcircBase | osa_circ_029683 |
Alias | Os06circ03189 |
Organism | Oryza sativa |
Position | chr6: 2560267-2561344 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os06g0149400 |
Parent gene annotation |
Similar to Chitinase A. (Os06t0149400-01) |
Parent gene strand | + |
Alternative splicing | Os06g0149450_circ_g.1 Os06g0149450_circ_g.3 Os06g0149450_circ_g.4 Os06g0149450_circ_g.5 |
Support reads | 2 |
Tissues | panicle |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0149450-00:5 Os06t0149400-01:6 Os06t0149450-00:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.334232653 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2560658-2560288(+) 2561108-2560274(+) |
Potential amino acid sequence |
MKTNEVLSEEIQERDEPALKYLKDIKWARIDDPKGFKLDFFFDTNPFFKNSVLTKTYHMVDEDE PILEKAIGTEIEWYPGKNLTQKILKKKPKKGSKNAKPITKTEVCESFFNFFSPPQVPDDDEDID EDTADELQGQMEHDYDIGASMMKSS*(+) MQSLLPKLKSVRASSTFSVPRKYPMMMRTLMKTLLMSFRVKWNMIMTLGPA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |