Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0149450_circ_g.2 |
| ID in PlantcircBase | osa_circ_029683 |
| Alias | Os06circ03189 |
| Organism | Oryza sativa |
| Position | chr6: 2560267-2561344 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os06g0149400 |
| Parent gene annotation |
Similar to Chitinase A. (Os06t0149400-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0149450_circ_g.1 Os06g0149450_circ_g.3 Os06g0149450_circ_g.4 Os06g0149450_circ_g.5 |
| Support reads | 2 |
| Tissues | panicle |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0149450-00:5 Os06t0149400-01:6 Os06t0149450-00:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.334232653 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2560658-2560288(+) 2561108-2560274(+) |
| Potential amino acid sequence |
MKTNEVLSEEIQERDEPALKYLKDIKWARIDDPKGFKLDFFFDTNPFFKNSVLTKTYHMVDEDE PILEKAIGTEIEWYPGKNLTQKILKKKPKKGSKNAKPITKTEVCESFFNFFSPPQVPDDDEDID EDTADELQGQMEHDYDIGASMMKSS*(+) MQSLLPKLKSVRASSTFSVPRKYPMMMRTLMKTLLMSFRVKWNMIMTLGPA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |