Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0805700_circ_g.2 |
ID in PlantcircBase | osa_circ_004460 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 34154725-34156000 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0805700 |
Parent gene annotation |
Similar to plectin-related. (Os01t0805700-01);Similar to plectin -related. (Os01t0805700-02) |
Parent gene strand | - |
Alternative splicing | Os01g0805700_circ_g.3 Os01g0805700_circ_g.4 Os01g0805700_circ_g.5 Os01g0805700_circ_g.6 Os01g0805700_circ_g.7 Os01g0805700_circ_g.8 Os01g0805700_circ_g.9 Os01g0805700_circ_g.10 Os01g0805700_circ_g.11 Os01g0805700_circ_g.12 Os01g0805700_circ_g.13 Os01g0805700_circ_g.14 Os01g0805700_circ_g.15 Os01g0805700_circ_g.16 Os01g0805700_circ_g.17 Os01g0805700_circ_g.18 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0805700-01:3 Os01t0805700-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130238826 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34154769-34155937(-) 34155904-34155937(-) |
Potential amino acid sequence |
MVYKSKRVILDHNEGATKPTYAPEPFDVGRLLQAEIVLNAEKVTIQTMGPINPAAGLEHYVESL MKRADVEFNVVVTQMNGNDYSSNSVHAFHIGKMRIKLRKGWSTKARESYSTTMKEQQNLHMLQN HLMLADCYRQR*(-) MGPINPAAGLEHYVESLMKRADVEFNVVVTQMNGNDYSSNSVHAFHIGKMRIKLRKGWSTKARE SYSTTMKEQQNLHMLQNHLMLADCYRQR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |