Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0144200_circ_g.5 |
| ID in PlantcircBase | osa_circ_026541 |
| Alias | Os_ciR10034 |
| Organism | Oryza sativa |
| Position | chr5: 2544357-2545206 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0144150 |
| Parent gene annotation |
Hypothetical gene. (Os05t0144150-00) |
| Parent gene strand | + |
| Alternative splicing | Os05g0144200_circ_g.1 Os05g0144200_circ_g.2 Os05g0144200_circ_g.3 Os05g0144200_circ_g.4 Os05g0144200_circ_g.6 |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0144200-01:4 Os05t0144200-01:4 Os05t0144150-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.24187348 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2545130-2544410(+) 2545032-2545143(-) |
| Potential amino acid sequence |
MDSASIHSHDIEPSLSSSQSSFGQEYIFFSDCFTRNNKWHRFGP*(+) MEDDSGDKILDIWGEDVKGDHKAKKRSTASVIPAVEVEAPGCSFNPPFEAHQDSLAQAVADEMR KIYTKELGPKPVPLIVPGEAITEEDIFLSKGRLRRRERRFYIMRVY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |