Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0144200_circ_g.1 |
| ID in PlantcircBase | osa_circ_026537 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 2542008-2543275 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0144150 |
| Parent gene annotation |
Hypothetical gene. (Os05t0144150-00) |
| Parent gene strand | + |
| Alternative splicing | Os05g0144200_circ_g.2 Os05g0144200_circ_g.3 Os05g0144200_circ_g.4 Os05g0144200_circ_g.5 Os05g0144200_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0144200-01:3 Os05t0144200-01:3 Os05t0144150-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113133353 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2543217-2542207(+) |
| Potential amino acid sequence |
MCLFSFSSSSLAISFIISGRLIFLLGASIPRFSMLLYRSLARLQHPFSFLREPLISSVNRT*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |