Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0258000_circ_g.3 |
| ID in PlantcircBase | osa_circ_038594 |
| Alias | Os_ciR5663 |
| Organism | Oryza sativa |
| Position | chr9: 4350804-4352976 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0258000 |
| Parent gene annotation |
Cellular retinaldehyde-binding/triple function, C-terminal domai n containing protein. (Os09t0258000-01);Similar to predicted pro tein. (Os09t0258000-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0258000_circ_g.1 Os09g0258000_circ_g.2 Os09g0258000_circ_g.4 Os09g0258000_circ_g.5 Os09g0258000_circ_g.6 Os09g0258000_circ_g.7 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0258000-02:6 Os09t0258000-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007974* |
| PMCS | 0.113602742 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4351843-4352414(-) |
| Potential amino acid sequence |
MNEYRDRVVLPKASKMFGKQINTCLKVMDMTGLKLSALNQIKMLSTITAIDDLNYPEKTETYFI VNAPYVFSACWKVVKPLLQERTKRKIKVLYGSGRDELLKHVHQGYARGTLVRFLKAREWNVPKA HKMLMDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLTGYSKQV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |