Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0258000_circ_g.6 |
ID in PlantcircBase | osa_circ_038597 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 4352418-4352818 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0258000 |
Parent gene annotation |
Cellular retinaldehyde-binding/triple function, C-terminal domai n containing protein. (Os09t0258000-01);Similar to predicted pro tein. (Os09t0258000-02) |
Parent gene strand | - |
Alternative splicing | Os09g0258000_circ_g.1 Os09g0258000_circ_g.2 Os09g0258000_circ_g.3 Os09g0258000_circ_g.4 Os09g0258000_circ_g.5 Os09g0258000_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0258000-02:2 Os09t0258000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.131961596 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4352817-4352420(-) |
Potential amino acid sequence |
MDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLTGYSKQLMDCLNWRIQNGIDSVLAKPI VPSDLYRTIRDTLLVGLTGYSKQLMDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLTGY SKQLMDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLTGYSKQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |