Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0258000_circ_g.7 |
| ID in PlantcircBase | osa_circ_038598 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 4352418-4352976 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os09g0258000 |
| Parent gene annotation |
Cellular retinaldehyde-binding/triple function, C-terminal domai n containing protein. (Os09t0258000-01);Similar to predicted pro tein. (Os09t0258000-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0258000_circ_g.1 Os09g0258000_circ_g.2 Os09g0258000_circ_g.3 Os09g0258000_circ_g.4 Os09g0258000_circ_g.5 Os09g0258000_circ_g.6 |
| Support reads | 5 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0258000-01:3 Os09t0258000-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127907185 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4352969-4352471(+) 4352897-4352420(-) |
| Potential amino acid sequence |
MDMLLGVSCQSNQQRIPNSSV*(+) MLMDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLTGYSKQHVHQGYARGTLVRFLKARE WNVPKAHKMLMDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLTGYSKQHVHQGYARGTL VRFLKAREWNVPKAHKMLMDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLTGYSKQHVH QGYARGTLVRFLKAREWNVPKAHKMLMDCLNWRIQNGIDSVLAKPIVPSDLYRTIRDTLLVGLT GYSKQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |