Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0575500_circ_g.2 |
| ID in PlantcircBase | osa_circ_002307 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 22164027-22166593 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0575500 |
| Parent gene annotation |
Similar to predicted protein. (Os01t0575500-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0575500_circ_g.1 Os01g0575500_circ_g.3 Os01g0575500_circ_g.4 Os01g0575500_circ_g.5 Os01g0575500_circ_g.6 Os01g0575500_circ_g.7 Os01g0575500_circ_g.8 Os01g0575500_circ_g.9 Os01g0575500_circ_g.10 Os01g0575500_circ_g.11 Os01g0575500_circ_g.12 Os01g0575500_circ_g.13 Os01g0575500_circ_g.14 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0575500-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.135875841 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22164068-22166528(-) 22166060-22166578(-) |
| Potential amino acid sequence |
MAALQNSPENCCYGQFEQLVQIVVKLFLELMINLS*(-) MLSGERVLTASHDGTVKMWDVRTDTCVATVGRCQSAVLCMEYDDSTGILAAAGRDVVAHVWDIR SSKQMFKLQGHTKWIRSMRMTGETIITGSDDWTARVWSLTRGTCDAVLACHAGPILCVEYSPSD KGIITGSSDGLIRFWENEGGIRCVKNLTLHSASVLSISASDHWLGIGAADNSMSLFHRPQERFG GFSNTGSKVAGWQLYRTPQKTAAMDNSSN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |