Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0944200_circ_g.7 |
| ID in PlantcircBase | osa_circ_005792 |
| Alias | Os_ciR3567 |
| Organism | Oryza sativa |
| Position | chr1: 41512824-41513012 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, circRNA_finder, find_circ |
| Parent gene | Os01g0944200 |
| Parent gene annotation |
Ribonuclease H-like domain containing protein. (Os01t0944200-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0944200_circ_g.1 Os01g0944200_circ_g.2 Os01g0944200_circ_g.3 Os01g0944200_circ_g.4 Os01g0944200_circ_g.5 Os01g0944200_circ_g.6 Os01g0944200_circ_igg.1 Os01g0944200_circ_g.2 Os01g0944200_circ_g.3 Os01g0944200_circ_g.4 Os01g0944200_circ_g.5 Os01g0944200_circ_g.6 Os01g0944200_circ_g.8 Os01g0944200_circ_g.9 Os01g0944200_circ_g.10 Os01g0944200_circ_g.11 Os01g0944200_circ_g.12 Os01g0944200_circ_g.13 |
| Support reads | 2/3 |
| Tissues | root/shoot, root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0944200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.330070547 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41512972-41513009(+) 41512997-41512890(+) |
| Potential amino acid sequence |
MIGITTRIDEHYTMGPVGKASLICGGKETHDAKILQIGDGGDSVHCVQKRRLISPCKCVRRKPM IGITTRIDEHYTMGPVGKASLICGGKETHDAKILQIGDGGDSVHCVQKRRLISPCKCVRRKPMI GITTRIDEHYTMGPVGKASLICGGKETHDAKILQIGDGGDSVHCVQKRRLISPCKCVRRKPMIG ITTRIDEHYTM(+) MSTTPWGRWARRHLFAEERKPMMPKFCR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |