Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0685800_circ_g.4 |
| ID in PlantcircBase | osa_circ_003330 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 28279342-28279877 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0685800 |
| Parent gene annotation |
Similar to ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14). (Os01t0685800-01);Similar to ATP synthase subunit bet a, mitochondrial. (Os01t0685800-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0685800_circ_g.1 Os01g0685800_circ_g.2 Os01g0685800_circ_g.3 Os01g0685800_circ_g.5 Os01g0685800_circ_g.6 Os01g0685800_circ_g.7 Os01g0685800_circ_g.8 Os01g0685800_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0685850-00:3 Os01t0685800-02:3 Os01t0685850-00:3 Os01t0685800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.346346517 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28279659-28279664(+) 28279692-28279689(-) |
| Potential amino acid sequence |
MELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQQQTTSSLSIVKPLLLLSK LQSNRFLLLELRSWISLHPIKEVVKLVSSVVLGWAKLYLLWS*(+) MSLRNIVDQLHNKYSFAHPSTTEETNFTTSLIGCKEIHDLNSSNKNLLLCSLLNKSRGFTMDRE EVVCCCLSPSLITPLSIISLYKSLPSRVRSPTPAKTEKPP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |