Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0485400_circ_g.1 |
ID in PlantcircBase | osa_circ_011490 |
Alias | Os_ciR2378 |
Organism | Oryza sativa |
Position | chr12: 17957148-17958076 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os12g0485400 |
Parent gene annotation |
Similar to Cyclin T1 (Fragment). (Os12t0485400-01) |
Parent gene strand | + |
Alternative splicing | Os12g0485400_circ_g.2 Os12g0485400_circ_g.3 Os12g0485400_circ_g.4 Os12g0485400_circ_g.5 Os12g0485400_circ_g.6 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0485400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009730 |
PMCS | 0.267417573 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17958077-17957212(+) 17957229-17957168(+) |
Potential amino acid sequence |
MLLRPLSIDKEVISSSVLSQYS*(+) MAMMPSDSSHHGIVENSPYRTTQGRNEETGELGASWYFSRKEIEENSPSRRDGIDLKKESYLRK SYCTFLQDLGMRLKVPQVTIATAIVFCHRFYLRQSHAKNDRRCCSGHFQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |