Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0485400_circ_g.1 |
| ID in PlantcircBase | osa_circ_011490 |
| Alias | Os_ciR2378 |
| Organism | Oryza sativa |
| Position | chr12: 17957148-17958076 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os12g0485400 |
| Parent gene annotation |
Similar to Cyclin T1 (Fragment). (Os12t0485400-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0485400_circ_g.2 Os12g0485400_circ_g.3 Os12g0485400_circ_g.4 Os12g0485400_circ_g.5 Os12g0485400_circ_g.6 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0485400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009730 |
| PMCS | 0.267417573 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17958077-17957212(+) 17957229-17957168(+) |
| Potential amino acid sequence |
MLLRPLSIDKEVISSSVLSQYS*(+) MAMMPSDSSHHGIVENSPYRTTQGRNEETGELGASWYFSRKEIEENSPSRRDGIDLKKESYLRK SYCTFLQDLGMRLKVPQVTIATAIVFCHRFYLRQSHAKNDRRCCSGHFQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |