Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0452500_circ_g.10 |
ID in PlantcircBase | osa_circ_014579 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 14946623-14950899 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os02g0452500 |
Parent gene annotation |
Similar to SNARE-interacting protein KEULE. (Os02t0452500-01) |
Parent gene strand | - |
Alternative splicing | Os02g0452500_circ_g.1 Os02g0452500_circ_g.2 Os02g0452500_circ_g.3 Os02g0452500_circ_g.4 Os02g0452500_circ_g.5 Os02g0452500_circ_g.6 Os02g0452500_circ_g.7 Os02g0452500_circ_g.8 Os02g0452500_circ_g.9 Os02g0452500_circ_g.11 Os02g0452500_circ_g.12 Os02g0452500_circ_g.13 Os02g0452500_circ_g.14 Os02g0452500_circ_g.15 Os02g0452500_circ_g.16 Os02g0452500_circ_g.17 Os02g0452500_circ_g.18 Os02g0452500_circ_g.19 Os02g0452500_circ_g.20 Os02g0452500_circ_g.21 Os02g0452500_circ_g.22 Os02g0452500_circ_g.23 Os02g0452500_circ_g.24 Os02g0452500_circ_g.25 Os02g0452500_circ_g.26 |
Support reads | 5 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0452500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.206295159 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14946929-14946677(+) 14950810-14946666(+) 14946687-14950878(-) |
Potential amino acid sequence |
MLLSLPQHEEKASQFDRCTVEELEPFFANLYWISLPQFCINFSPLSLSNLSGLIAA*(+) MKRKLLNLIAVLWKSLNHFLQISIGYLSPSSASIFHPCHFRTCLG*(+) MIYAAINPDKFESDKGEKLMQNWGRDIQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |