Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0452500_circ_g.10 |
| ID in PlantcircBase | osa_circ_014579 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 14946623-14950899 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os02g0452500 |
| Parent gene annotation |
Similar to SNARE-interacting protein KEULE. (Os02t0452500-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0452500_circ_g.1 Os02g0452500_circ_g.2 Os02g0452500_circ_g.3 Os02g0452500_circ_g.4 Os02g0452500_circ_g.5 Os02g0452500_circ_g.6 Os02g0452500_circ_g.7 Os02g0452500_circ_g.8 Os02g0452500_circ_g.9 Os02g0452500_circ_g.11 Os02g0452500_circ_g.12 Os02g0452500_circ_g.13 Os02g0452500_circ_g.14 Os02g0452500_circ_g.15 Os02g0452500_circ_g.16 Os02g0452500_circ_g.17 Os02g0452500_circ_g.18 Os02g0452500_circ_g.19 Os02g0452500_circ_g.20 Os02g0452500_circ_g.21 Os02g0452500_circ_g.22 Os02g0452500_circ_g.23 Os02g0452500_circ_g.24 Os02g0452500_circ_g.25 Os02g0452500_circ_g.26 |
| Support reads | 5 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0452500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.206295159 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14946929-14946677(+) 14950810-14946666(+) 14946687-14950878(-) |
| Potential amino acid sequence |
MLLSLPQHEEKASQFDRCTVEELEPFFANLYWISLPQFCINFSPLSLSNLSGLIAA*(+) MKRKLLNLIAVLWKSLNHFLQISIGYLSPSSASIFHPCHFRTCLG*(+) MIYAAINPDKFESDKGEKLMQNWGRDIQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |