Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0461000_circ_g.4 |
ID in PlantcircBase | osa_circ_009314 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 15722052-15722355 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0461000 |
Parent gene annotation |
Peptidase S10, serine carboxypeptidase family protein. (Os11t046 1000-01);Hypothetical conserved gene. (Os11t0461000-02);Peptidas e S10, serine carboxypeptidase family protein. (Os11t0461000-03) |
Parent gene strand | + |
Alternative splicing | Os11g0461000_circ_igg.1 Os11g0461000_circ_igg.2 Os11g0461000_circ_igg.3 Os11g0461000_circ_g.1 Os11g0461000_circ_g.2 Os11g0461000_circ_g.3 Os11g0461000_circ_g.5 Os11g0461000_circ_g.6 Os11g0461000_circ_g.7 Os11g0461000_circ_g.8 |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0461000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.34895487 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15722295-15722055(+) 15722088-15722078(+) 15722329-15722335(-) |
Potential amino acid sequence |
MKVVKFHFSMAWDLYPMNFMRQ*(+) MGYVAGNPRTERQFDEGGKIPFLHGMGLISNELYEAMIQEINQF*(+) MPWRNGILPPSSNWRSVLGLPATYPMRFKIGLSPESLPHKVHWI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |