Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0461000_circ_g.4 |
| ID in PlantcircBase | osa_circ_009314 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 15722052-15722355 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0461000 |
| Parent gene annotation |
Peptidase S10, serine carboxypeptidase family protein. (Os11t046 1000-01);Hypothetical conserved gene. (Os11t0461000-02);Peptidas e S10, serine carboxypeptidase family protein. (Os11t0461000-03) |
| Parent gene strand | + |
| Alternative splicing | Os11g0461000_circ_igg.1 Os11g0461000_circ_igg.2 Os11g0461000_circ_igg.3 Os11g0461000_circ_g.1 Os11g0461000_circ_g.2 Os11g0461000_circ_g.3 Os11g0461000_circ_g.5 Os11g0461000_circ_g.6 Os11g0461000_circ_g.7 Os11g0461000_circ_g.8 |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0461000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.34895487 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15722295-15722055(+) 15722088-15722078(+) 15722329-15722335(-) |
| Potential amino acid sequence |
MKVVKFHFSMAWDLYPMNFMRQ*(+) MGYVAGNPRTERQFDEGGKIPFLHGMGLISNELYEAMIQEINQF*(+) MPWRNGILPPSSNWRSVLGLPATYPMRFKIGLSPESLPHKVHWI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |