Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G33980_circ_g.11 |
| ID in PlantcircBase | ath_circ_016357 |
| Alias | AT2G33980_C3, AT2G33980_C3 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14355448-14356826 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT2G33980 |
| Parent gene annotation |
nudix hydrolase homolog 22 |
| Parent gene strand | - |
| Alternative splicing | AT2G33980_circ_g.1 AT2G33980_circ_g.2 AT2G33980_circ_g.3 AT2G33980_circ_g.4 AT2G33980_circ_g.5 AT2G33980_circ_g.6 AT2G33980_circ_g.7 AT2G33980_circ_g.8 AT2G33980_circ_g.9 AT2G33980_circ_g.10 AT2G33980_circ_g.12 AT2G33980_circ_g.13 AT2G33980_circ_g.14 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G33980.1:2 AT2G33980.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.32927165 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14356791-14356808(-) 14355463-14356808(-) |
| Potential amino acid sequence |
MIVFVHISIVCAERQAHSWKVFQHAFWMTLVSEINRFKLSNSSDARAKHTACVI* MQEQSILLALSSWNIIKMIVFVHISIVCAERQAHSWKVFQHAFWMTLVSEINRFKLSNSSDARA KHTACVI* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |