Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0542200_circ_g.7 |
| ID in PlantcircBase | osa_circ_007865 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 21171548-21171837 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0542200 |
| Parent gene annotation |
Ubiquilin domain containing protein. (Os10t0542200-01);Hypotheti cal conserved gene. (Os10t0542200-03) |
| Parent gene strand | - |
| Alternative splicing | Os10g0542200_circ_g.2 Os10g0542200_circ_g.3 Os10g0542200_circ_g.4 Os10g0542200_circ_g.5 Os10g0542200_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0542266-00:1 Os10t0542266-00:1 Os10t0542200-03:1 Os10t0542200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.397002989 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21171556-21171573(+) 21171600-21171744(-) |
| Potential amino acid sequence |
MDCGSDMIFCIICIITGFCKIWLKEEESGEPPSKLPKSAEPNPPRPPVAPVPVLPARPPNKLLR SADPNPPRPPVAPVLALPVEPARVAPCAPPAGSWTVDQT*(+) MMQMMQNIMSDPQSMNQLEVRKEQHGQVLLAMQEPVPLGALEGWGQLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |