Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0542200_circ_g.3 |
| ID in PlantcircBase | osa_circ_007862 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 21170196-21171457 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0542200 |
| Parent gene annotation |
Ubiquilin domain containing protein. (Os10t0542200-01);Hypotheti cal conserved gene. (Os10t0542200-03) |
| Parent gene strand | - |
| Alternative splicing | Os10g0542200_circ_g.2 Os10g0542200_circ_g.4 Os10g0542200_circ_g.5 Os10g0542200_circ_g.6 Os10g0542200_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0542266-00:2 Os10t0542200-03:4 Os10t0542200-01:4 Os10t0542266-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216385347 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21171424-21171238(+) 21171426-21171452(-) 21170200-21171452(-) |
| Potential amino acid sequence |
MRLRVFGLKLSNIGCIGYTYATSSTKPTKHAHQGVEANISPHACRIASLATILPRLILTKL*(+ ) MESNTQLREMFQNPEFIRQLTSPETMQQLLSFQQTLLSQLGQNQPRQDGSQGGNATGMRGNVSL DTLMGMLSGLGAGGGIGVPNTSNVA*(-) MLLNFNPNTRNLMESNTQLREMFQNPEFIRQLTSPETMQQLLSFQQTLLSQLGQNQPRQDGSQG GNATGMRGNVSLDTLMGMLSGLGAGGGIGVPNTSNVA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |