Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0542200_circ_g.2 |
ID in PlantcircBase | osa_circ_007861 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 21170196-21171271 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0542200 |
Parent gene annotation |
Ubiquilin domain containing protein. (Os10t0542200-01);Hypotheti cal conserved gene. (Os10t0542200-03) |
Parent gene strand | - |
Alternative splicing | Os10g0542200_circ_g.3 Os10g0542200_circ_g.4 Os10g0542200_circ_g.5 Os10g0542200_circ_g.6 Os10g0542200_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0542266-00:1 Os10t0542266-00:1 Os10t0542200-03:3 Os10t0542200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21501755 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21171248-21171221(+) 21170288-21171218(-) 21170200-21171218(-) |
Potential amino acid sequence |
MSAGTRVIALDVLGTPMPPPAPSPLSMPIKVSRLTFPRMPVALPPWLPSCLG*(+) MRGNVSLDTLMGMLSGLGAGGGIGVPNTSNAITLVPADIIITAWSKST*(-) MQLLSFQQTLLSQLGQNQPRQDGSQGGNATGMRGNVSLDTLMGMLSGLGAGGGIGVPNTSNAIT LVPADIIITAWSKST*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |