Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0195600_circ_g.3 |
ID in PlantcircBase | osa_circ_030063 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 4845977-4848092 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0195600 |
Parent gene annotation |
Similar to SAC domain protein 3. (Os06t0195600-01) |
Parent gene strand | - |
Alternative splicing | Os06g0195600_circ_g.1 Os06g0195600_circ_g.2 Os06g0195600_circ_g.4 Os06g0195600_circ_g.5 Os06g0195600_circ_g.6 Os06g0195600_circ_g.7 Os06g0195600_circ_g.8 Os06g0195600_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0195600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016754 |
PMCS | 0.213382926 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4848004-4848067(-) 4846039-4848012(-) |
Potential amino acid sequence |
MDAYKQAAINLFLGYFQPCEGEPALWELEPVAGEGVLGENASKLMKRARSDGSILRKSNASMSS NGRNGVLKSSFIDSKSELQSPNSSSDAINEISSAPDNTVTVSKSRYTPTEPHVKHVSCELDYCN GSGDSNFLDIDWLSSSDNERYSLQREDT*(-) MVLVIQISWTLTGFHLQTTKDILCKERTLKVRYPVARVLQDTAKILQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |