Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0254400_circ_g.1 |
| ID in PlantcircBase | osa_circ_010990 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 8671448-8672665 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0254400 |
| Parent gene annotation |
Hypothetical protein. (Os12t0254400-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0255200_circ_igg.1 Os12g0254400_circ_g.2 Os12g0254400_circ_g.3 Os12g0254400_circ_g.4 Os12g0255200_circ_g.1 Os12g0255200_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0254400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211129326 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8672648-8671494(+) 8671810-8672554(-) |
| Potential amino acid sequence |
MHKLVFPSQEICYNTMPLCQLY*(+) MQLYMTYQACPMGDLQMGDSVVSTIDIRALYCNKSPGKGTLTYALKIQFHIWRKIVVGCIENEK VGYTAKYGLLG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |