Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0254400_circ_g.4 |
ID in PlantcircBase | osa_circ_010993 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 8671785-8672665 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0254400 |
Parent gene annotation |
Hypothetical protein. (Os12t0254400-01) |
Parent gene strand | - |
Alternative splicing | Os12g0255200_circ_igg.1 Os12g0254400_circ_g.1 Os12g0254400_circ_g.2 Os12g0254400_circ_g.3 Os12g0255200_circ_g.1 Os12g0255200_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0254400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.10404826 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8671810-8672554(-) 8671862-8672594(-) |
Potential amino acid sequence |
MQLYMTYQGTLTYALKIQFHIWRKIVVGCIENEKVGYTAKYGLLG*(-) MREKYDEDWLAKNLDIDHAVVHDISGNTNLCIEDSVSYMEENRSWMYRE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |