Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0773600_circ_g.5 |
| ID in PlantcircBase | osa_circ_022054 |
| Alias | Os_ciR1611 |
| Organism | Oryza sativa |
| Position | chr3: 32066144-32068204 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0773600 |
| Parent gene annotation |
Kinesin, motor region domain containing protein. (Os03t0773600-0 1);Hypothetical conserved gene. (Os03t0773600-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0773600_circ_g.1 Os03g0773600_circ_g.2 Os03g0773600_circ_g.3 Os03g0773600_circ_g.4 Os03g0773600_circ_g.6 Os03g0773600_circ_g.7 Os03g0773600_circ_g.8 Os03g0773600_circ_g.9 Os03g0773600_circ_g.10 Os03g0773600_circ_g.11 Os03g0773600_circ_g.12 Os03g0773600_circ_g.13 Os03g0773600_circ_g.14 Os03g0773600_circ_g.15 Os03g0773600_circ_g.16 Os03g0773600_circ_g.17 Os03g0773600_circ_g.18 Os03g0773600_circ_g.19 Os03g0773600_circ_g.20 |
| Support reads | 8/4 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0773600-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013704 |
| PMCS | 0.334713569 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32066940-32066180(+) 32068154-32066151(+) 32066955-32068162(-) |
| Potential amino acid sequence |
MVGTHSDPGLMVLSFRTIFDLVKKDDSKDTFEVSCSYLEVYNEVIYDLLEKSSGHLELREDPVH GIMVAGLRSIKVHSADKILELLNIGNSRRKTESTEANSTSSRSHAVLEITVKRKQKGQYGSQVL RGKLALVDLAGRMYIRIYLLQLLV*(+) MVVRFFVESLRWLTLRAGCI*(+) MGSNHCISFPTSSRTISKDCRIKALNYTSNCRRYILIYILPARSTNASFPRRT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |