Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0486400_circ_g.20 |
| ID in PlantcircBase | osa_circ_030887 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 16611320-16612670 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0486400 |
| Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os06 t0486400-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0486400_circ_g.14 Os06g0486400_circ_g.15 Os06g0486400_circ_g.16 Os06g0486400_circ_g.17 Os06g0486400_circ_g.18 Os06g0486400_circ_g.19 Os06g0486400_circ_g.21 Os06g0486400_circ_g.22 Os06g0486400_circ_g.23 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0486400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157848211 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16612608-16611744(+) 16612585-16611322(+) 16612645-16612663(-) |
| Potential amino acid sequence |
MLEEDLDDQSSSWFVLLVLSHLVIITMQLLHNFWSHPARGPYKSVSCSLPIPSIKHAG*(+) MTICKRAICSKKIWMINQAHGLYFSSYPIL*(+) MSLIDHPNLLRAYCSFTNGHQLWVIMPYMAAGSALHIMKTSFPDGFEEPVIATLLREVLKALVY LHSQGHIHRDVKAGNILIDTNGAVKLGDFGVSACMFDTGNRQRARNTFVGTPCWMAPEVMQQLH GYDYKMG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |