Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0486400_circ_g.17 |
ID in PlantcircBase | osa_circ_030884 |
Alias | Os_ciR10373 |
Organism | Oryza sativa |
Position | chr6: 16610993-16611231 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0486400 |
Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os06 t0486400-01) |
Parent gene strand | - |
Alternative splicing | Os06g0486400_circ_g.14 Os06g0486400_circ_g.15 Os06g0486400_circ_g.16 Os06g0486400_circ_g.18 Os06g0486400_circ_g.19 Os06g0486400_circ_g.20 Os06g0486400_circ_g.21 Os06g0486400_circ_g.22 Os06g0486400_circ_g.23 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0486400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.528894944 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16611174-16611017(+) 16611157-16611228(-) 16611020-16611228(-) |
Potential amino acid sequence |
MEHDHVLVPMPLYQRTKCQLFENRLSLS*(+) MKVLLMTLQNAPPGLDYERDKRFSKS*(-) MRGTSDFQRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |