Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0486400_circ_g.17 |
| ID in PlantcircBase | osa_circ_030884 |
| Alias | Os_ciR10373 |
| Organism | Oryza sativa |
| Position | chr6: 16610993-16611231 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0486400 |
| Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os06 t0486400-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0486400_circ_g.14 Os06g0486400_circ_g.15 Os06g0486400_circ_g.16 Os06g0486400_circ_g.18 Os06g0486400_circ_g.19 Os06g0486400_circ_g.20 Os06g0486400_circ_g.21 Os06g0486400_circ_g.22 Os06g0486400_circ_g.23 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0486400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.528894944 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16611174-16611017(+) 16611157-16611228(-) 16611020-16611228(-) |
| Potential amino acid sequence |
MEHDHVLVPMPLYQRTKCQLFENRLSLS*(+) MKVLLMTLQNAPPGLDYERDKRFSKS*(-) MRGTSDFQRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |